HORDB

ID: hor006249
Uniprot ID: Q02747
Protein name: HMW-guanylin
Gene name: GUCA2A
Organism: Homo sapiens (Human)
Family: Guanylin family
Source: Human
Expression: Highly expressed in ileum and colon. Found in plasma.
Disease: Diseases associated with GUCA2A include Large Intestine Adenoma and Secretory Diarrhea.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005515 protein binding; GO:0030250 guanylate cyclase activator activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: VTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
Length: 94
Propeptide: MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
Signal peptide: MNAFLLSALCLLGAWAALAGG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006249_AF2.pdb

hor006249_ESM.pdb

Mass:	1200185	Formula:	C455H725N119O143S6
Absent amino acids:	HMW	Common amino acids:	EP
pI:	4.26	Basic residues:	9
Polar residues:	24	Hydrophobic residues:	30
Hydrophobicity:	-33.72	Boman Index:	-14001
Half-Life:	100 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	82.98
Instability Index:	6346.28	Extinction Coefficient cystines:	1865
Absorbance 280nm:	20.05

PubMed ID: 1327879
Title: Human guanylin: cDNA isolation, structure, and activity.
PubMed ID: 1409606
Title: Precursor structure, expression, and tissue distribution of human guanylin.
PubMed ID: 7892222
Title: Analysis of the human guanylin gene and the processing and cellular localization of the peptide.
PubMed ID: 16710414
Title: The DNA sequence and biological annotation of human chromosome 1.
PubMed ID: 8095028
Title: The circulating bioactive form of human guanylin is a high molecular weight peptide (10.3 kDa).
PubMed ID: 7947768
Title: Determination of the solution structure of the peptide hormone guanylin: observation of a novel form of topological stereoisomerism.
PubMed ID: 12707255
Title: Solution structure of human proguanylin: the role of a hormone prosequence.